PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009639P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 383aa    MW: 41220 Da    PI: 8.7945
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009639P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.73.4e-4380155176
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                     +CqvegC++dl++ak y++rhkvC++hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  MELO3C009639P1  80 RCQVEGCRVDLTDAKAYYSRHKVCTMHSKSPKVIVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKP 155
                     6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.9E-3575142IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.52278155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-4179160IPR004333Transcription factor, SBP-box
PfamPF031102.2E-3281154IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEMDCSSLTE SGGSSNSSPP NSSAESLNGL KFGQKIYFED VGIAELPKSG GGSFSSSAVI  60
ASTPTKKPRG GVVHPAQPPR CQVEGCRVDL TDAKAYYSRH KVCTMHSKSP KVIVAGLEQR  120
FCQQCSRFHQ LPEFDQGKRS CRRRLAGHNE RRRKPPPGSL LSPRYGRFSS SIFENSNRVG  180
SFLMDFSAYP KLAGKDVWLS GTKASERVLG NRSIGSIGKY VPHPWQSNSE NNQPELLLPV  240
SAGGTSFSGP GNPSGGECIN SVTDSSCALS LLSNESWGSR NRTTTVEVNA LLNAEGTLVA  300
QTTTHAATNH FPTMSWGFKG NEAPPSSFLD LTSDLGLNHQ VSHALTSSFS GDVQFPHLAR  360
RPYMELGHSG AFDSTQHLHW SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31811541184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443072.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotA3C0573e-60SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0A0LBC10.0A0A0A0LBC1_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g06270.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-60squamosa promoter binding protein-like 9